Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 3-191
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
KEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGK
YKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATE
LEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDG
EEVVKGQEL
Structures of the domain Q8RQE8 3-191
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oy5 X-ray 3.1 D 3-159 None
5x21 X-ray 3.32 D 3-159 None
6kql X-ray 2.89 D 3-159 None
6l74 X-ray 3.12 D 3-159 None
4oir X-ray 3.1 D 3-159 None
6lts X-ray 3.45 D 3-159 None
6kqg X-ray 2.78 D 3-159 None
4g7z X-ray 3.81 N 3-159 None
4g7z X-ray 3.81 D 3-159 None
4g7o X-ray 2.99 N 3-159 None
4g7o X-ray 2.99 D 3-159 None
4g7h X-ray 2.9 N 3-159 None
4g7h X-ray 2.9 D 3-159 None
4oiq X-ray 3.62 D 3-159 None
6p70 X-ray 3.05 D 3-159 None
4q4z X-ray 2.9 D 3-159 None
4q5s X-ray 3 D 5-159 None
4oin X-ray 2.8 D 3-159 None
4oip X-ray 3.4 D 3-159 None
6kqe X-ray 3.3 D 3-159 None
4oio X-ray 3.1 D 3-159 None
6ovr X-ray 2.84 D 3-159 None
5e17 X-ray 3.2 D 3-159 None
6ow3 X-ray 2.77 D 3-159 None
6kqn X-ray 3.49 D 3-159 None
5d4c X-ray 3.28 N 3-159 None
5d4c X-ray 3.28 D 3-159 None
5d4d X-ray 3 N 3-159 None
5d4d X-ray 3 D 3-159 None
5vo8 X-ray 3.3 D 3-159 None
6kqf X-ray 2.45 D 3-159 None
6p71 X-ray 2.92 D 3-159 None
5d4e X-ray 3.08 N 3-159  H-Bb 
5d4e X-ray 3.08 D 3-159 None
6kqm X-ray 3.2 D 3-159 None
5e18 X-ray 3.3 D 3-159 None
5x22 X-ray 3.35 D 3-159 None
5x22 X-ray 3.35 N 3-159 None
6kqh X-ray 3.18 D 3-159 None
6oy7 X-ray 3.04 D 3-159 None
6ovy X-ray 3 D 5-159 None
6kqd X-ray 3.3 D 3-159 None
6kqd X-ray 3.3 N 3-159 None
6oy6 X-ray 3.1 D 3-159 None
5voi X-ray 2.8 D 3-159 None
6wox X-ray 3.14 D 3-159 None
6woy X-ray 3 D 3-159 None


© NPIDB team 2003 - 2021

text