Pfam domain
Pfam family: TBP (PF00352.23)
Uniprot AC: Q8ST28
RecName: TRANSCRIPTION INITIATION FACTOR TFIID (TFIID-1)
Begin-End: 22-104
Organism: Encephalitozoon cuniculi
Interaction Mode:   

Sequence:
IPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVI
TGAKSEKSSRMAAQRYAKIIHKL
Structures of the domain Q8ST28 22-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wzs X-ray 3.78 D 22-104  S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2021

text