Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q8SWT2
RecName: GH12763p
Begin-End: 156-320
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
MKYADDIIQAVRENQVILIVGSTGCGKTTQVPQILLDDAISRGCASSCRIICTQPRRISA
IAIAEWVSYERCESLGNSVGYQIRLESRKARERASITYCTTGVLLQQLQSDPLMHNLSVL
ILDEIHERSVETDLLMGLLKVILPHRPDLKVILMSATVREQDFCD
Structures of the domain Q8SWT2 156-320
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5n90 X-ray 3.07 B 156-320 None
5n90 X-ray 3.07 A 156-320 None
5n8u X-ray 2.62 B 156-320 None
5n8u X-ray 2.62 A 156-320 None
5n8z X-ray 3.48 B 156-320 None
5n8z X-ray 3.48 A 156-320 None
5n9a X-ray 3.04 B 156-320 None
5n9a X-ray 3.04 A 156-320 None
5n9d X-ray 2.71 B 156-320 None
5n9d X-ray 2.71 A 156-320 None
5n8s X-ray 2.88 B 156-320 None
5n8s X-ray 2.88 A 156-320 None
5n9e X-ray 3.01 B 156-320 None
5n9e X-ray 3.01 A 156-320 None
5n94 X-ray 2.43 B 156-320 None
5n94 X-ray 2.43 A 156-320 None
5n9f X-ray 2.97 B 156-320 None
5n9f X-ray 2.97 A 156-320 None
5n98 X-ray 2.76 B 156-320 None
5n98 X-ray 2.76 A 156-320 None
5n8r X-ray 2.2 B 156-320 None
5n8r X-ray 2.2 A 156-320 None
5n96 X-ray 2.72 B 156-320 None
5n96 X-ray 2.72 A 156-320 None


© NPIDB team 2003 - 2021

text