Pfam domain
Pfam family: DNA_photolyase (PF00875.20)
Uniprot AC: Q8SXK5
RecName: RE11660p
Begin-End: 8-186
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb L-Bb 

Sequence:
LVHWFRKGLRLHDNPALSHIFTAANAAPGRYFVRPIFILDPGILDWMQVGANRWRFLQQT
LEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAK
AEGVRVETHCSHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKVPKVLGVPEKLKNMPT
Structures of the domain Q8SXK5 8-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cvw X-ray 3.2 A 8-186  H-Bb 
3cvx X-ray 3.2 A 8-186  H-Bb 
2wb2 X-ray 2.95 A 8-186  H-Bb 
3cvu X-ray 2 A 8-186  H-Bb L-Bb 
3cvv X-ray 2.1 A 8-186  H-Bb L-Bb 
2wq7 X-ray 2 A 8-186  H-Bb L-Bb 
2wq6 X-ray 2.3 A 8-186  H-Bb 
3cvy X-ray 2.7 A 8-186  H-Bb 


© NPIDB team 2003 - 2021

text