Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: Q8TAQ2
RecName: SWI/SNF complex subunit SMARCC2
Begin-End: 598-643
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLP
Structures of the domain Q8TAQ2 598-643
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ltj X-ray 3.7 O 598-643 None
6ltj X-ray 3.7 N 602-672 None


© NPIDB team 2003 - 2021

text