Pfam domain
Pfam family: DOT1 (PF08123.15)
Uniprot AC: Q8TEK3
RecName: Histone-lysine N-methyltransferase, H3 lysine-79 specific
Begin-End: 115-317
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVA
AATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIAN
TSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVV
ELSPLKGSVSWTGKPVSYYLHTI
Structures of the domain Q8TEK3 115-317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nog X-ray 3.9 K 108-317 None
6jm9 X-ray 7.3 X 115-317 None
6o96 X-ray 3.5 K 115-317 None
6nn6 X-ray 3.9 K 115-317 None
6nqa X-ray 3.54 K 115-317 None
6j99 X-ray 4.1 K 115-317 None
6jma X-ray 6.8 X 115-317 None
6nj9 X-ray 2.96 K 115-317 None


© NPIDB team 2003 - 2021

text