Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: Q8U014
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
DPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQ
LLGRINKAGAIKPRFPVKVSEFEKWEKRFLPAFEFGILIVSTSQGVMSHKEAIEKGIGGR
LIAYVY
Structures of the domain Q8U014 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 I 5-130 None
5jbh X-ray 5.34 I 5-130 None


© NPIDB team 2003 - 2021

text