Pfam domain
Pfam family: PolC_DP2 (PF03833.15)
Uniprot AC: Q8U1R4
RecName: Ribosome biogenesis protein Nop10
Begin-End: 2-49
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
RFRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWK
Structures of the domain Q8U1R4 2-49
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hvy X-ray 2.3 C 3-50 None
3lwr X-ray 2.2 B 3-50 None
3hay X-ray 4.99 C 3-50 None
3lwv X-ray 2.5 B 3-50 None
3lwo X-ray 2.85 B 3-50 None
3lwp X-ray 2.5 B 3-50 None
3lwq X-ray 2.68 B 4-49 None
2rfk X-ray 2.87 B 3-50 None
3hax X-ray 2.11 C 3-50 None
3mqk X-ray 2.8 B 4-50 None
3hjw X-ray 2.35 B 3-50 None
3hjy X-ray 3.65 B 3-50 None


© NPIDB team 2003 - 2021

text