Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: Q8U3I4
RecName: Cell division control protein 21
Begin-End: 103-231
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
MVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKC
EQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVI
VTGILRVVL
Structures of the domain Q8U3I4 103-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pog X-ray 3.2 L 103-231 None
4pog X-ray 3.2 J 103-231 None
4pog X-ray 3.2 K 103-231 None
4pog X-ray 3.2 I 103-231 None
4pog X-ray 3.2 H 103-231 None
4pog X-ray 3.2 G 103-231 None
4pog X-ray 3.2 F 103-231 None
4pog X-ray 3.2 D 103-231 None
4pog X-ray 3.2 E 103-231 None
4pog X-ray 3.2 C 103-231 None
4pog X-ray 3.2 B 103-231 None
4pog X-ray 3.2 A 103-231 None


© NPIDB team 2003 - 2021

text