Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q8U3I4
RecName: Cell division control protein 21
Begin-End: 7-97
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
IERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEE
GISAAEDAIQIVLREDFQREDVGKIHARFYN
Structures of the domain Q8U3I4 7-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pog X-ray 3.2 L 7-97 None
4pog X-ray 3.2 J 7-97 None
4pog X-ray 3.2 K 7-97 None
4pog X-ray 3.2 I 7-97 None
4pog X-ray 3.2 H 7-97 None
4pog X-ray 3.2 G 7-119 None
4pog X-ray 3.2 F 7-97 None
4pog X-ray 3.2 E 7-97 None
4pog X-ray 3.2 D 7-97 None
4pog X-ray 3.2 C 7-97 None
4pog X-ray 3.2 B 7-97 None
4pog X-ray 3.2 A 7-97 None


© NPIDB team 2003 - 2021

text