Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: Q8VDF2
RecName: E3 ubiquitin-protein ligase UHRF1
Begin-End: 422-590
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
HFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYF
TYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVR
NMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTE
Structures of the domain Q8VDF2 422-590
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2zo0 X-ray 2.19 B 422-590  H-Bb S-Bb L-Bb L-Mj L-Mn 
2zo0 X-ray 2.19 B 422-590 None
3fde X-ray 1.41 A 421-589  H-Bb S-Bb L-Bb L-Mj L-Mn 
3fde X-ray 1.41 B 422-590  H-Bb S-Bb L-Bb L-Mj L-Mn 
2zo2 X-ray 3.09 B 422-590 None
2zo2 X-ray 3.09 B 422-590 None
2zo2 X-ray 3.09 B 422-590 None
3f8j X-ray 1.99 B 422-590  H-Bb S-Bb L-Bb L-Mj 
2zo1 X-ray 1.96 B 422-590  H-Bb S-Bb L-Bb L-Mj L-Mn 
2zo1 X-ray 1.96 B 422-590 None
2zke X-ray 2.6 A 422-590  L-Bb L-Mj 
2zkf X-ray 2.55 A 422-590  L-Bb L-Mj L-Mn 
3f8i X-ray 2.29 A 422-590  H-Bb L-Bb L-Mj 
3f8i X-ray 2.29 B 422-590  H-Bb S-Bb L-Bb L-Mj 
2zkd X-ray 1.6 B 422-590  H-Bb S-Bb L-Bb L-Mj L-Mn 
2zkd X-ray 1.6 A 422-590  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text