Pfam domain
Pfam family: HIN (PF02760.17)
Uniprot AC: Q91VJ1
RecName: Interferon-inducible protein AIM2
Begin-End: 158-321
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
DPLVVTVLKAINPFECETQEGRQEIFHATVATETDFFFVKVLNAQFKDKFIPKRTIKISN
YLWHSNFMEVTSSSVVVDVESNHEVPNNVVKRARETPRISKLKIQPCGTIVNGLFKVQKI
TEEKDRVLYGIHDKTGTMEVLVLGNPSKTKCEEGDKIRLTFFEV
Structures of the domain Q91VJ1 158-321
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jbm X-ray 2.22 A 1-165  H-Bb H-Mj S-Bb L-Bb 
4jbm X-ray 2.22 B 1-165 None


© NPIDB team 2003 - 2021

text