Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q91XB0
RecName: Three-prime repair exonuclease 1
Begin-End: 10-189
Organism: Mus musculus
Interaction Mode:   

Sequence:
HMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRPPRVVDKLSL
CIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRY
DFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLGSIYTRLYWQ
Structures of the domain Q91XB0 10-189
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ywt X-ray 1.7 B 15-208 None
3u6f X-ray 2.3 A 15-205 None


© NPIDB team 2003 - 2021

text