Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q91XB0
RecName: Three-prime repair exonuclease 1
Begin-End: 15-197
Organism: Mus musculus
Interaction Mode:   

Sequence:
IFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRPPRVVDKLSLCIAPG
KACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLL
QTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLGSIYTRLYWQAPTDS
HTA
Structures of the domain Q91XB0 15-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2oa8 X-ray 2.1 A 15-208 None
5ywt X-ray 1.7 A 15-208 None
5ywv X-ray 2.3 B 15-208 None
5ywv X-ray 2.3 A 15-208 None
5ywu X-ray 3.4 A 15-208 None


© NPIDB team 2003 - 2021

text