Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q91XB0
RecName: Three-prime repair exonuclease 1
Begin-End: 16-202
Organism: Mus musculus
Interaction Mode:   

Sequence:
FLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRPPRVVDKLSLCIAPGK
ACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQ
TELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLGSIYTRLYWQAPTDSH
TAEGDVL
Structures of the domain Q91XB0 16-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2oa8 X-ray 2.1 B 15-208 None


© NPIDB team 2003 - 2021

text