Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q92133
RecName: Histone H3
Begin-End: 33-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMA
LQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIR
Structures of the domain Q92133 33-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7crp X-ray 3.2 M 32-131  H-Bb H-Mj S-Bb L-Bb 
7crr X-ray 3.48 M 32-131  H-Bb H-Mj S-Bb L-Bb 
7crq X-ray 3.15 M 32-131  H-Bb H-Mj L-Bb 
7cro X-ray 3.75 M 32-131  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text