Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q92133
RecName: Histone H3
Begin-End: 39-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE
AYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIR
Structures of the domain Q92133 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g0l X-ray 10 A 38-131 None
6g0l X-ray 10 E 39-131 None
7crp X-ray 3.2 E 37-131  H-Bb L-Bb L-Mn 
6ugm X-ray 3.7 A 38-131  H-Bb S-Bb L-Bb 
6ugm X-ray 3.7 E 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6uh5 X-ray 3.5 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6uh5 X-ray 3.5 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7crr X-ray 3.48 E 37-131  H-Bb L-Bb 
6vz4 X-ray 3.9 A 38-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6vz4 X-ray 3.9 E 41-132  H-Bb H-Mj S-Bb L-Bb 
7crq X-ray 3.15 E 35-131  H-Bb L-Bb L-Mn 
7cro X-ray 3.75 E 37-131  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text