Pfam domain
Pfam family: WD40 (PF00400.34)
Uniprot AC: Q92466
RecName: DNA damage-binding protein 2
Begin-End: 232-271
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWD
Structures of the domain Q92466 232-271
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r8y X-ray 4.3 L 232-271  L-Bb 
4e54 X-ray 2.85 B 232-271 None
4e5z X-ray 3.22 B 232-271 None
6r8z X-ray 3.9 L 232-271 None
6r90 X-ray 4.5 L 232-271  L-Bb 
6r92 X-ray 4.8 L 232-271  L-Bb 
6r91 X-ray 4.1 L 232-271  L-Bb 


© NPIDB team 2003 - 2021

text