Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: Q924Q6
RecName: VH186.2-D-J-C mu protein (Fragment)
Begin-End: 6-119
Organism: Mus musculus
Interaction Mode:   

Sequence:
QPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFK
SKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARSTLSHYYAMDYWGQGTSVTVS
Structures of the domain Q924Q6 6-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i8m X-ray 2.1 H 6-112 None
1i8m X-ray 2.1 B 6-112 None


© NPIDB team 2003 - 2021

text