Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q92620
RecName: Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
Begin-End: 535-694
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVA
KRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEA
HERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAA
Structures of the domain Q92620 535-694
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7a5p X-ray 5 r 535-694 None


© NPIDB team 2003 - 2021

text