Pfam domain
Pfam family: ERCC4 (PF02732.17)
Uniprot AC: Q92889
RecName: DNA repair endonuclease XPF
Begin-End: 686-816
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQC
ISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRILWCPS
PHATAELFEEL
Structures of the domain Q92889 686-816
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sxb X-ray 7.9 F 686-816 None


© NPIDB team 2003 - 2021

text