Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q93077
RecName: Histone H2A type 1-C
Begin-End: 16-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain Q93077 16-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 K 15-90 None
6upl X-ray 7.4 C 11-90 None
6upk X-ray 4.9 C 11-90 None
6c0w X-ray 4 G 15-90 None
6c0w X-ray 4 C 14-90 None
6mup X-ray 3.5 G 13-90 None
6mup X-ray 3.5 C 14-90 None
6muo X-ray 3.6 G 13-90 None
6muo X-ray 3.6 C 14-90 None
7a08 X-ray 3.11 f 14-90 None
7a08 X-ray 3.11 b 13-90 None


© NPIDB team 2003 - 2021

text