Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: Q94CL7
RecName: Protein PHOSPHATE STARVATION RESPONSE 1
Begin-End: 227-278
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYR
Structures of the domain Q94CL7 227-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4r X-ray 2.8 D 227-278  H-Bb H-Mj L-Bb 
6j4r X-ray 2.8 A 227-278  H-Bb H-Mj L-Bb 
6j4r X-ray 2.8 C 227-278  H-Bb H-Mj L-Bb L-Mn 
6j4r X-ray 2.8 B 227-278  H-Bb H-Mj L-Bb L-Mn 
6j5b X-ray 2.7 F 227-278  H-Bb H-Mj L-Bb 
6j5b X-ray 2.7 C 227-278  H-Bb H-Mj L-Bb L-Mn 
6j5b X-ray 2.7 D 227-278  H-Bb H-Mj L-Bb 
6j5b X-ray 2.7 A 227-278  H-Bb H-Mj L-Bb 
6j5b X-ray 2.7 H 227-278  H-Bb H-Mj L-Bb L-Mn 
6j5b X-ray 2.7 J 227-278  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text