Pfam domain
Pfam family: IBD (PF10416.11)
Uniprot AC: Q95VR4
RecName: 39 kDa initiator binding protein
Begin-End: 10-112
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
FTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTEFKMKK
KNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTR
Structures of the domain Q95VR4 10-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pp8 X-ray 3.05 O 20-112 None
1pp8 X-ray 3.05 V 20-112 None


© NPIDB team 2003 - 2021

text