Pfam domain
Pfam family: IBD (PF10416.11)
Uniprot AC: Q95VR4
RecName: 39 kDa initiator binding protein
Begin-End: 5-112
Organism: Trichomonas vaginalis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
DLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTE
FKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTR
Structures of the domain Q95VR4 5-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pp7 X-ray 2.45 U 6-112  H-Bb H-Mj S-Bb L-Bb L-Mn 
1pp8 X-ray 3.05 P 5-112  H-Bb H-Mj L-Bb L-Mn 
1pp8 X-ray 3.05 F 5-112  H-Bb H-Mj S-Bb L-Bb 
1pp8 X-ray 3.05 M 5-112  H-Bb H-Mj L-Bb L-Mn 
1pp8 X-ray 3.05 U 5-112  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text