Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q96A08
RecName: Histone H2B type 1-A
Begin-End: 35-103
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSR
EIQTAVRLL
Structures of the domain Q96A08 35-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gt3 X-ray 2.91 H 34-101  H-Bb S-Bb L-Bb 
5gt3 X-ray 2.91 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3wkj X-ray 2.8 H 34-102  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 D 33-102  H-Bb H-Mj S-Bb L-Bb 
5gsu X-ray 3.1 H 30-99  H-Bb L-Bb 
5gsu X-ray 3.1 D 27-99  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text