Pfam domain
Pfam family: ERCC4 (PF02732.17)
Uniprot AC: Q96AY2
RecName: Crossover junction endonuclease EME1
Begin-End: 256-439
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVL
LRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALSLVIVDQEKCFSAQNP
PRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTEAQAQIVQSWKELADF
TCAF
Structures of the domain Q96AY2 256-439
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4p0p X-ray 2.8 B 256-439 None
4p0q X-ray 2.85 B 256-439 None
4p0r X-ray 6.5 B 256-439 None
4p0r X-ray 6.5 D 256-439 None
4p0s X-ray 6 B 256-439 None
4p0s X-ray 6 D 256-439 None
4p0s X-ray 6 F 256-439 None
4p0s X-ray 6 H 256-439 None


© NPIDB team 2003 - 2021

text