Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: Q96FI4
RecName: Endonuclease 8-like 1
Begin-End: 130-210
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIP
PFEKARSVLEALQQHRPSPEL
Structures of the domain Q96FI4 130-210
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5itu X-ray 2.41 C 134-224  H-Bb 


© NPIDB team 2003 - 2021

text