Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: Q96FI4
RecName: Endonuclease 8-like 1
Begin-End: 131-221
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
PGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPP
FEKARSVLEALQQHRPSPELTLSQKIRTKLQ
Structures of the domain Q96FI4 131-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5itr X-ray 2.46 C 134-255  H-Bb 
5itt X-ray 2.53 C 134-237 None
5itu X-ray 2.41 B 134-256  H-Bb L-Bb 
5itx X-ray 2.65 E 134-243  H-Bb 


© NPIDB team 2003 - 2021

text