Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: Q96FI4
RecName: Endonuclease 8-like 1
Begin-End: 134-228
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
GPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEK
ARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLEL
Structures of the domain Q96FI4 134-228
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5itr X-ray 2.46 B 134-256  H-Bb L-Bb 
5itr X-ray 2.46 A 134-248  H-Bb L-Bb 
5itt X-ray 2.53 B 134-256  H-Bb 
5itt X-ray 2.53 A 134-248  H-Bb 
5itu X-ray 2.41 A 134-248  H-Bb 
5itx X-ray 2.65 B 134-254  H-Bb 
5itx X-ray 2.65 A 134-254  H-Bb 
5ity X-ray 2.48 C 134-254 None
5ity X-ray 2.48 B 134-254  H-Bb L-Bb 
5ity X-ray 2.48 A 134-251  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text