Pfam domain
Pfam family: CENP-N (PF05238.15)
Uniprot AC: Q96H22
RecName: Centromere protein N
Begin-End: 3-212
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRAS
ISDAALLDIIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVS
FRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIA
SKHHQIVKMDLRSRYLDSLKAIVFKQYNQT
Structures of the domain Q96H22 3-212
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c0w X-ray 4 K 3-212 None
6mup X-ray 3.5 N 3-212 None
6mup X-ray 3.5 M 3-212 None
6muo X-ray 3.6 M 3-212 None


© NPIDB team 2003 - 2021

text