Pfam domain
Pfam family: ERCC4 (PF02732.17)
Uniprot AC: Q96NY9
RecName: Crossover junction endonuclease MUS81
Begin-End: 273-415
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Mn 

Sequence:
VDIGETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIV
ERKRLDDLCSSIIDGRFREQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQ
VIDGFFVKRTADIKESAAYLALL
Structures of the domain Q96NY9 273-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4p0p X-ray 2.8 A 273-415  H-Bb H-Mj H-Mn L-Mn 
4p0q X-ray 2.85 A 273-415  H-Mj H-Mn L-Mn 
4p0r X-ray 6.5 A 273-415  H-Bb H-Mj 
4p0r X-ray 6.5 C 273-415  H-Bb H-Mj L-Bb 
4p0s X-ray 6 A 273-415 None
4p0s X-ray 6 C 273-415 None
4p0s X-ray 6 E 273-415 None
4p0s X-ray 6 G 273-415 None


© NPIDB team 2003 - 2021

text