Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: Q96PU4
RecName: E3 ubiquitin-protein ligase UHRF2
Begin-End: 446-616
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
HYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEF
TYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVI
RSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVE
Structures of the domain Q96PU4 446-616
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pw6 X-ray 3.79 B 446-616 None
4pw6 X-ray 3.79 A 446-616 None
4pw5 X-ray 2.2 B 446-616  H-Bb S-Bb L-Bb L-Mj 
4pw5 X-ray 2.2 A 446-616  H-Bb S-Bb L-Bb L-Mj 
4pw5 X-ray 2.2 F 446-616  H-Bb S-Bb L-Bb L-Mj 
4pw5 X-ray 2.2 E 446-616  H-Bb S-Bb L-Bb L-Mj L-Mn 
4pw7 X-ray 2 B 446-616  H-Bb S-Bb L-Bb L-Mj 
4pw7 X-ray 2 A 446-616  H-Bb S-Bb L-Bb L-Mj L-Mn 
4pw7 X-ray 2 F 446-616  H-Bb S-Bb L-Bb L-Mj 
4pw7 X-ray 2 E 446-616  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text