Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q96QV6
RecName: Histone H2A type 1-A
Begin-End: 15-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDN
KKTRIIPRHLQLAIRND
Structures of the domain Q96QV6 15-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gt0 X-ray 2.82 G 13-90  H-Bb S-Bb L-Bb 
5gt0 X-ray 2.82 C 14-90  H-Bb S-Bb L-Bb 
5gsu X-ray 3.1 G 16-92  H-Bb S-Bb L-Bb 
5gsu X-ray 3.1 C 15-92  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text