Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: Q96RK0
RecName: Protein capicua homolog
Begin-End: 200-268
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEA
HFKAHPDWK
Structures of the domain Q96RK0 200-268
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jrp X-ray 3 A 199-268  H-Bb H-Mn L-Bb L-Mn 
6jrp X-ray 3 D 199-268  H-Bb H-Mn L-Bb L-Mn 
6jrp X-ray 3 G 199-268  H-Bb H-Mn L-Bb L-Mn 
6jrp X-ray 3 J 199-268  H-Bb H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text