Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: Q96T88
RecName: E3 ubiquitin-protein ligase UHRF1
Begin-End: 417-586
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
HYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFF
TYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVV
RNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDE
Structures of the domain Q96T88 417-586
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3clz X-ray 2.2 A 417-586  H-Bb S-Bb L-Bb L-Mj L-Mn 
3clz X-ray 2.2 D 417-586  H-Bb S-Bb L-Bb L-Mj 
3clz X-ray 2.2 C 417-586  H-Bb S-Bb L-Bb L-Mj L-Mn 
3clz X-ray 2.2 B 417-586  H-Bb S-Bb L-Bb L-Mj L-Mn 
6vcs X-ray 1.7 E 417-586  S-Bb 
6vcs X-ray 1.7 A 417-586  L-Bb L-Mj L-Mn 
6vcs X-ray 1.7 B 417-585  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text