Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: Q97W02
RecName: DNA polymerase IV
Begin-End: 242-341
Organism: Sulfolobus solfataricus
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 

Sequence:
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT
FPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Structures of the domain Q97W02 242-341
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bq3 X-ray 2 A 242-341  S-Bb S-Mj L-Bb 
2va3 X-ray 2.98 A 242-342 None
2v4q X-ray 2.6 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2agp X-ray 2.9 B 242-341  H-Bb S-Bb S-Mj L-Bb 
2agp X-ray 2.9 A 242-341  S-Bb S-Mj L-Bb 
2au0 X-ray 2.7 B 1242-1341  S-Bb S-Mj L-Bb 
2au0 X-ray 2.7 A 242-341  S-Bb L-Bb L-Mj 
2c2r X-ray 2.55 A 242-341  H-Bb S-Bb S-Mj L-Bb 
1s0m X-ray 2.7 B 242-341  S-Bb L-Bb 
1s0m X-ray 2.7 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3khl X-ray 2.1 A 242-341  H-Bb S-Bb L-Bb 
3khl X-ray 2.1 B 1242-1341  S-Bb S-Mj L-Bb 
3qz7 X-ray 2 A 242-341  S-Bb S-Mj L-Bb 
2bqr X-ray 2.37 A 242-341  S-Bb L-Bb 
2ia6 X-ray 2.5 B 242-341  H-Bb S-Bb L-Bb 
2ia6 X-ray 2.5 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2r8g X-ray 2.7 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2agq X-ray 2.1 A 242-341  H-Bb S-Bb L-Bb 
2c28 X-ray 2.27 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2uvr X-ray 2.9 A 242-341  S-Bb L-Bb 
3pw4 X-ray 2.9 A 243-342  S-Bb L-Bb 
2r8h X-ray 2.48 A 242-341  S-Bb S-Mj L-Bb 
2w9a X-ray 2.6 A 242-341  S-Bb S-Mj L-Bb 
2j6u X-ray 2.5 A 245-344  H-Bb S-Bb S-Mj L-Bb 
3rbd X-ray 2.5 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3rbd X-ray 2.5 B 1242-1341  S-Bb S-Mj L-Bb 
2j6t X-ray 2.6 A 242-341  S-Bb S-Mj L-Bb 
1s97 X-ray 2.4 D 242-341  S-Bb S-Mj L-Bb 
1s97 X-ray 2.4 C 242-341  H-Bb S-Bb L-Bb 
1s97 X-ray 2.4 B 242-341  S-Bb S-Mj L-Bb 
1s97 X-ray 2.4 A 242-341  S-Bb L-Bb 
2w9c X-ray 2.87 B 242-341  S-Bb S-Mj L-Bb 
2w9c X-ray 2.87 A 242-341  S-Bb S-Mj L-Bb 
3v6k X-ray 3.6 J 242-341  S-Bb S-Mj L-Bb 
3v6k X-ray 3.6 A 242-342  H-Bb S-Bb L-Bb L-Mj 
2w8l X-ray 3 A 242-341  S-Bb L-Bb 
3khg X-ray 2.96 B 1242-1341  S-Bb S-Mj L-Bb 
3khg X-ray 2.96 A 242-341  S-Bb S-Mj L-Bb 
2bqu X-ray 2.5 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2uvu X-ray 2.7 A 242-342  H-Bb S-Bb L-Bb 
3m9n X-ray 1.93 B 242-341  H-Bb S-Bb L-Bb 
4gc7 X-ray 2.89 B 242-341  S-Bb S-Mj L-Bb 
4gc7 X-ray 2.89 A 242-341  S-Bb S-Mj L-Bb 
4g3i X-ray 2.5 A 242-341  S-Bb S-Mj L-Bb L-Mj 
4g3i X-ray 2.5 B 242-341  H-Bb S-Bb S-Mj L-Bb 
2v9w X-ray 3 A 242-343 None
2v9w X-ray 3 B 242-342 None
2w9b X-ray 2.28 B 242-341 None
2w9b X-ray 2.28 A 242-341 None
2asj X-ray 2.35 B 1242-1341  S-Bb S-Mj L-Bb 
2asj X-ray 2.35 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2ago X-ray 2.85 A 242-341  S-Bb S-Mj L-Bb L-Mj 
2xcp X-ray 2.6 B 242-341  S-Bb L-Bb 
2xcp X-ray 2.6 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2br0 X-ray 2.17 A 242-341  S-Bb S-Mj L-Bb 
4f4w X-ray 1.9 B 243-342  S-Bb S-Mj L-Bb 
4f4w X-ray 1.9 A 243-342  H-Bb S-Bb S-Mj L-Bb L-Mj 
2uvw X-ray 2.09 A 242-341  H-Bb S-Bb L-Bb 
2c2e X-ray 2.61 A 242-341  S-Bb S-Mj L-Bb 
2c22 X-ray 2.56 A 242-341  S-Bb S-Mj L-Bb 
2w8k X-ray 3.1 A 242-341  H-Bb S-Bb L-Bb 
2xc9 X-ray 2.2 A 242-341  S-Bb S-Mj L-Bb 
2r8i X-ray 2.38 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3khh X-ray 2.7 B 1242-1341  S-Bb S-Mj L-Bb 
3khh X-ray 2.7 A 242-341  S-Bb L-Bb 
1s9f X-ray 2 D 242-341  H-Bb S-Bb L-Bb 
1s9f X-ray 2 C 242-341  S-Bb L-Bb 
1s9f X-ray 2 B 242-341  S-Bb L-Bb 
1s9f X-ray 2 A 242-341  H-Bb S-Bb L-Bb 
3rb3 X-ray 2.8 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2ibk X-ray 2.25 A 242-341  H-Bb S-Bb S-Mj L-Bb 
2asd X-ray 1.95 B 1242-1341  H-Bb S-Bb S-Mj L-Bb 
2asd X-ray 1.95 A 242-341  S-Bb S-Mj L-Bb 
3pw7 X-ray 2.9 E 245-344  H-Bb S-Bb L-Bb 
3pw7 X-ray 2.9 A 245-344  H-Bb S-Bb L-Bb 
3pr5 X-ray 2.4 B 242-341  H-Bb S-Bb L-Bb 
3pr4 X-ray 2.65 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3qz8 X-ray 2 A 242-341  H-Bb S-Bb 
2asl X-ray 2.65 B 1242-1341  S-Bb S-Mj L-Bb 
2asl X-ray 2.65 A 242-341  S-Bb S-Mj L-Bb 
3khr X-ray 2.01 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3khr X-ray 2.01 B 1242-1341  S-Bb S-Mj L-Bb 
2atl X-ray 2.8 B 1242-1341  S-Bb S-Mj L-Bb 
2atl X-ray 2.8 A 242-341  S-Bb L-Bb 
1n48 X-ray 2.2 A 242-342  H-Bb S-Bb L-Bb L-Mj 
3pvx X-ray 3.03 A 242-341  S-Bb L-Bb 
3pw2 X-ray 2.74 A 243-342  S-Bb L-Bb 
3pw0 X-ray 2.91 A 242-341  H-Bb S-Bb L-Bb 
3gik X-ray 2.9 A 242-341  S-Bb S-Mj L-Bb 
3gij X-ray 2.4 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3gij X-ray 2.4 B 1242-1341  S-Bb S-Mj L-Bb 
3gii X-ray 2.6 A 242-341  S-Bb S-Mj L-Bb 
1jx4 X-ray 1.7 A 228-341  H-Bb S-Bb L-Bb 
2xca X-ray 2.5 A 242-341  S-Bb S-Mj L-Bb 
1ryr X-ray 2.28 A 242-341  S-Bb S-Mj L-Bb 
2rdj X-ray 2.2 A 242-341  S-Bb S-Mj L-Bb 
2rdj X-ray 2.2 B 242-341  H-Bb S-Bb S-Mj L-Bb 
3v6j X-ray 2.3 J 242-342  H-Bb S-Bb S-Mn L-Bb 
3v6j X-ray 2.3 A 242-342  S-Bb S-Mn L-Bb 
3gim X-ray 2.7 A 242-341  S-Bb S-Mj L-Bb 
3v6h X-ray 2.3 A 242-342  H-Bb S-Bb S-Mn L-Bb 
3v6h X-ray 2.3 B 242-342  H-Bb S-Bb S-Mn L-Bb 
2va2 X-ray 2.8 B 242-342 None
2va2 X-ray 2.8 A 242-342 None
3m9o X-ray 2 B 242-341  H-Bb S-Bb L-Bb 
4gc6 X-ray 2.9 A 242-341  S-Bb S-Mj L-Bb 
3t5h X-ray 2.35 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3t5l X-ray 2.9 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3t5j X-ray 2.4 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3t5k X-ray 2.9 A 242-341  S-Bb S-Mj L-Bb 
3rb6 X-ray 2.7 B 1242-1341  S-Bb S-Mj L-Bb 
3rb6 X-ray 2.7 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3rax X-ray 1.89 B 1242-1341  H-Bb S-Bb S-Mj L-Bb 
3rax X-ray 1.89 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3rb0 X-ray 3.23 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3rb0 X-ray 3.23 B 1242-1341  S-Bb L-Bb 
3raq X-ray 2.25 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3raq X-ray 2.25 B 1242-1341  S-Bb S-Mj L-Bb 
3rbe X-ray 2.8 A 242-341  S-Bb S-Mj L-Bb 
3rbe X-ray 2.8 B 1242-1341  S-Bb S-Mj L-Bb 
3rb4 X-ray 2.81 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3rb4 X-ray 2.81 B 1242-1341  S-Bb S-Mj L-Bb 
4jv1 X-ray 2.3 A 242-341  S-Bb S-Mj L-Bb 
4juz X-ray 2.65 A 242-341  S-Bb L-Bb 
4jv2 X-ray 2.74 A 242-341  S-Bb S-Mj L-Bb 
4jv0 X-ray 2.95 A 242-341  H-Bb S-Bb L-Bb 
4fbt X-ray 2 A 242-341  H-Bb S-Bb L-Bb 
4fbu X-ray 2.6 A 242-341  H-Bb S-Bb S-Mj L-Bb 
4fbu X-ray 2.6 B 242-341  S-Bb S-Mj L-Bb 
1rys X-ray 2.03 B 242-341  H-Bb S-Bb S-Mj L-Bb 
1rys X-ray 2.03 A 242-341  H-Bb S-Bb S-Mj L-Bb 
4f4x X-ray 2.05 A 243-342  H-Bb S-Bb S-Mj L-Bb 
2jej X-ray 1.86 A 242-341  S-Bb S-Mj L-Bb 
4qw9 X-ray 2.4 A 242-341  H-Bb S-Bb S-Mj L-Bb 
4qwe X-ray 2.2 A 242-341  H-Bb S-Bb L-Bb 
4qwc X-ray 2.4 D 242-342  S-Bb S-Mj L-Bb 
4qwc X-ray 2.4 A 242-342  S-Bb L-Bb 
4qwa X-ray 2.2 A 242-341  H-Bb S-Bb S-Mj L-Bb 
4qwb X-ray 1.8 A 242-343  H-Bb S-Bb S-Mj L-Bb 
4rzr X-ray 2.2 D 242-342  S-Bb L-Bb 
4rzr X-ray 2.2 A 242-342  S-Bb S-Mj L-Bb 
4qwd X-ray 2.05 A 242-341  H-Bb S-Bb L-Bb 
4qw8 X-ray 2.29 A 242-341  H-Bb S-Bb S-Mj L-Bb 
4tqr X-ray 1.58 A 242-342  H-Bb S-Bb S-Mj L-Bb 
4ruc X-ray 2.9 A 242-341  S-Bb S-Mj L-Bb 
4rua X-ray 3.07 A 242-341  S-Bb S-Mj L-Bb 
1s0n X-ray 2.8 A 242-341  S-Bb S-Mj L-Bb 
1s10 X-ray 2.1 A 242-341  H-Bb S-Bb L-Bb 
2c2d X-ray 2.57 A 242-341  H-Bb S-Bb S-Mj L-Bb 
3m9m X-ray 2.9 B 242-341  S-Bb S-Mj L-Bb 
3gil X-ray 2.71 B 1242-1341  S-Bb S-Mj L-Bb 
3gil X-ray 2.71 A 242-341  S-Bb S-Mj L-Bb 
5edw X-ray 2.62 A 242-341  S-Bb L-Bb 
1s0o X-ray 2.1 B 242-341  H-Bb S-Bb S-Mj L-Bb 
1s0o X-ray 2.1 A 242-341  S-Bb S-Mj L-Bb 
2uvv X-ray 2.2 A 242-342  H-Bb S-Bb L-Bb 
2jeg X-ray 2.38 A 242-341  S-Bb S-Mj L-Bb 
2j6s X-ray 2.5 A 242-341  S-Bb L-Bb 
3pw5 X-ray 3 A 243-342  H-Bb S-Bb L-Bb 
2v4r X-ray 2.5 A 243-342  S-Bb S-Mj L-Bb 
6l84 X-ray 2.6 A 242-341  S-Bb S-Mj L-Bb 
2jef X-ray 2.17 A 242-341  S-Bb L-Bb 
1jxl X-ray 2.1 A 242-341  H-Bb S-Bb 
4tqs X-ray 2.06 A 242-342  S-Bb S-Mj L-Bb 
4tqs X-ray 2.06 B 242-342  H-Bb S-Bb S-Mj L-Bb 
2jei X-ray 2.39 A 242-341  S-Bb S-Mj L-Bb 
1n56 X-ray 2.4 A 242-341  H-Bb S-Bb L-Bb 
1n56 X-ray 2.4 B 242-341  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text