Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: Q97W02
RecName: DNA polymerase IV
Begin-End: 242-347
Organism: Sulfolobus solfataricus
Interaction Mode:  S-Bb S-Mj L-Bb 

Sequence:
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT
FPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLD
Structures of the domain Q97W02 242-347
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2imw X-ray 2.05 P 242-346  S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text