Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: Q97W02
RecName: DNA polymerase IV
Begin-End: 248-341
Organism: Sulfolobus solfataricus
Interaction Mode:  H-Bb S-Bb 

Sequence:
IVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGIS
KETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Structures of the domain Q97W02 248-341
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4f50 X-ray 2.22 A 189-342  H-Bb S-Bb 


© NPIDB team 2003 - 2021

text