Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: Q97XQ7
RecName: Helicase of the snf2/rad54 family (Amino end), hypothetical
Begin-End: 433-720
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
QLLEPYNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENEL
TPSLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDTRLK
EVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDLWSIMTFLNPGL
LGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKAIINDLPDKIETNVYCNL
TPEQAAMYKAEVENLFNNIDSVTGIKRKGMILSTLLKLKQIVDHPALL
Structures of the domain Q97XQ7 433-720
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1z63 X-ray 3 B 447-720  H-Bb L-Bb 
1z63 X-ray 3 A 447-720  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text