Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: Q97Z79
RecName: Translation initiation factor 2 subunit alpha
Begin-End: 8-83
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
LPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVK
VIRVDRRKGTVDVSLK
Structures of the domain Q97Z79 8-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 9 8-83 None
3v11 X-ray 5 B 8-83 None
5jb3 X-ray 5.34 9 8-83 None
6swc X-ray 3.3 9 8-83 None
5jbh X-ray 5.34 9 8-83 None


© NPIDB team 2003 - 2021

text