Pfam domain
Pfam family: SRP54_N (PF02881.21)
Uniprot AC: Q97ZE7
RecName: Signal recognition particle 54 kDa protein
Begin-End: 1-78
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKP
PSVLERKEWFISIVYDEL
Structures of the domain Q97ZE7 1-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1qzw X-ray 4.1 G 1-78 None
1qzw X-ray 4.1 E 1-78 None
1qzw X-ray 4.1 C 1-78 None
1qzw X-ray 4.1 A 1-78 None


© NPIDB team 2003 - 2021

text