Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: Q97ZJ8
RecName: Omega-protein
Begin-End: 10-142
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
YLIIAEKSKAAKKIAEALSEKPILCRKYNVSYWIIKDHNSSKYVIVPAAGHLFGLKGESG
FPVYDADWKPLWEIDKNSYYTKRYYQLISSLSKYALGFINACDYDIEGSVIGYLIIKNLG
DIKKAKRMKFSAL
Structures of the domain Q97ZJ8 10-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k8o X-ray 2.5 A 10-142 None


© NPIDB team 2003 - 2021

text