Pfam domain
Pfam family: Med11 (PF10280.11)
Uniprot AC: Q99278
RecName: Mediator of RNA polymerase II transcription subunit 11
Begin-End: 7-109
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQL
RKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAIL
Structures of the domain Q99278 7-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 V 7-104 None
5oqm X-ray 5.8 c 7-104 None
5sva X-ray 15.3 O 7-114 None


© NPIDB team 2003 - 2021

text