Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: Q99315
RecName: Transposon Ty3-G Gag-Pol polyprotein
Begin-End: 639-797
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEP
KDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPE
EHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSI
Structures of the domain Q99315 639-797
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ol8 X-ray 3.1 A 91-298 None
4ol8 X-ray 3.1 B 104-262 None
4ol8 X-ray 3.1 F 104-262 None
4ol8 X-ray 3.1 E 91-262 None


© NPIDB team 2003 - 2021

text