Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q99459
RecName: Cell division cycle 5-like protein
Begin-End: 11-71
Organism: Homo sapiens
Interaction Mode:   

Sequence:
WRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEK
L
Structures of the domain Q99459 11-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mqf X-ray 5.9 L 3-63 None
6id0 X-ray 2.9 L 11-71 None
6ff7 X-ray 4.5 L 11-71 None
6zym X-ray 3.4 L 11-71 None
5z58 X-ray 4.9 L 19-79 None
7aav X-ray 4.2 L 11-71 None
6icz X-ray 3 L 11-71 None
6id1 X-ray 2.86 L 19-79 None
6ff4 X-ray 3.4 L 11-71 None


© NPIDB team 2003 - 2021

text