Pfam domain
Pfam family: Forkhead (PF00250.20)
Uniprot AC: Q99958
RecName: Forkhead box protein C2
Begin-End: 73-148
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVK
VPRDDKKPGKGSYWTL
Structures of the domain Q99958 73-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o3t X-ray 3.06 B 73-148  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text