Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: Q99XG5
RecName: DNA gyrase subunit A
Begin-End: 33-474
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 

Sequence:
RALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVR
MAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDG
NEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMED
IEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKAR
MIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFG
VNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHID
EIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYI
SELETILADEEVLLQLVRDELT
Structures of the domain Q99XG5 33-474
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5npk X-ray 1.98 d 1033-1474 None
5npk X-ray 1.98 b 1033-1474 None
5npk X-ray 1.98 D 1035-1476 None
5npk X-ray 1.98 B 1030-1471 None
6fqm X-ray 3.06 c 33-474 None
6fqm X-ray 3.06 a 33-474 None
6fqm X-ray 3.06 C 33-475 None
6fqm X-ray 3.06 A 34-482 None
6fqs X-ray 3.11 A 33-474 None
6fqs X-ray 3.11 C 33-474 None
6fqv X-ray 2.6 T 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6fqv X-ray 2.6 R 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6fqv X-ray 2.6 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6fqv X-ray 2.6 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
2xcr X-ray 3.5 U 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
2xcr X-ray 3.5 S 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
2xcr X-ray 3.5 D 1033-1474  H-Bb H-Mj S-Bb L-Bb L-Mn 
2xcr X-ray 3.5 B 1033-1474  H-Bb S-Bb S-Mn L-Bb 
2xcs X-ray 2.1 D 1033-1474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 
2xcs X-ray 2.1 B 1033-1474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 
2xct X-ray 3.35 D 1033-1474  H-Bb S-Bb S-Mj S-Mn 
2xct X-ray 3.35 B 1033-1474  H-Bb H-Mj L-Bb L-Mj L-Mn 
2xct X-ray 3.35 U 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
2xct X-ray 3.35 S 1032-1473  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdm X-ray 2.5 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdm X-ray 2.5 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdn X-ray 2.79 R 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdn X-ray 2.79 T 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdn X-ray 2.79 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdn X-ray 2.79 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdo X-ray 3.15 T 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdo X-ray 3.15 R 33-474  H-Bb S-Mj S-Mn L-Bb 
5cdo X-ray 3.15 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdo X-ray 3.15 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdp X-ray 2.45 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
5cdp X-ray 2.45 C 33-474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 
5cdq X-ray 2.95 T 33-474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5cdq X-ray 2.95 R 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdq X-ray 2.95 C 33-474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5cdq X-ray 2.95 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
5cdr X-ray 2.65 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
5cdr X-ray 2.65 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
4bul X-ray 2.6 C 1032-1473  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
4bul X-ray 2.6 A 1032-1473  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6qtp X-ray 2.37 A 33-474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
6qtp X-ray 2.37 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6qx2 X-ray 3.4 L 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 J 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 t 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 r 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 R 31-472  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 T 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 l 33-474  H-Bb S-Bb S-Mj S-Mn 
6qx2 X-ray 3.4 j 34-476  H-Bb S-Bb S-Mj S-Mn 
6qx2 X-ray 3.4 c 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx2 X-ray 3.4 a 33-476  H-Bb S-Bb S-Mj S-Mn L-Bb 
5npp X-ray 2.22 D 1033-1474 None
5npp X-ray 2.22 B 1033-1474 None
5iwi X-ray 1.98 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
5iwi X-ray 1.98 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
5iwm X-ray 2.5 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
5iwm X-ray 2.5 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6qx1 X-ray 2.65 C 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qx1 X-ray 2.65 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6fm4 X-ray 2.7 D 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6fm4 X-ray 2.7 B 1033-1474  H-Bb S-Bb S-Mj S-Mn L-Bb 
6qtk X-ray 2.31 C 33-474  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb L-Mn 
6qtk X-ray 2.31 A 33-474  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text