Pfam domain
Pfam family: PDDEXK_1 (PF12705.9)
Uniprot AC: Q9BQP7
RecName: Mitochondrial genome maintenance exonuclease 1
Begin-End: 204-335
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GYIESVQHILKDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQ
STFDNPLQVVAYMGAMNHDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAELCSQYWTKWLL
RLEEYTEKKKNQ
Structures of the domain Q9BQP7 204-335
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zyt X-ray 2.7 A 201-332 None
5zyt X-ray 2.7 B 137-331 None
5zyt X-ray 2.7 C 136-331 None
5zyt X-ray 2.7 D 204-330 None
5zyv X-ray 2.72 A 133-331 None
5zyu X-ray 1.75 A 190-334 None
5zyu X-ray 1.75 B 190-334 None


© NPIDB team 2003 - 2021

text