Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9BRT9
RecName: DNA replication complex GINS protein SLD5
Begin-End: 21-127
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQM
EMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEEL
Structures of the domain Q9BRT9 21-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 D 25-127 None


© NPIDB team 2003 - 2021

text